Neuromedin B

neuromedin B
Identifiers
Symbol	NMB
Entrez	4828
HUGO	7842
OMIM	162340
RefSeq	NM_021077
UniProt	P08949
Other data
Locus	Chr. 15 q11-qter

Neuromedin B (NMB) is a bombesin-related peptide in mammals.^[1][2] It was originally purified from pig spinal cord, and later shown to be present in human central nervous system and gastrointestinal tract.^[3]

Contents

• 
  1 Sequence
  


• 
  2 Function
  


• 
  3 Neuromedin signaling pathway
  


• 
  4 References
  


• 
  5 External links
  

Sequence

The sequence of the C-terminal decapeptide is highly conserved across mammalian species: GNLWATGHFM-(NH2); this decapeptide is sometimes noted as neuromedin B, but it is more accurately described as neuromedin B 23-32. The sequence of neuromedin B (in rat) is : TPFSWDLPEPRSRASKIRVHPRGNLWATGHFM-(NH2).^[4]

Function

Figure 1: NMB, 7-TMR receptor and G-protein

Figure 2 : Signal Cascade after NMB binding

Neuromedin regulates the following functions:

• 
  exocrine and endocrine secretions


• cell growth


• body temperature


• blood pressure and glucose level

Neuromedin signaling pathway

NMB acts by binding to its high affinity cell surface receptor, neuromedin B receptor (NMBR). This receptor is a G protein-coupled receptor with seven transmembrane spanning regions, hence the receptor is also denoted as a 7-transmembrane receptor (7-TMR). Upon binding several intracellular signaling pathways are triggered (see Figure 2).

When NMB binds to its 7-TMR, the heterotrimeric G protein that is attached to the receptor is activated. The G-protein is called heterotrimeric because it consists of 3 polypeptides: α subunit, β subunit, and γ subunit. In the activated NMBR/G-protein complex, there occurs an exchange of GTP for GDP bound to G-α subunit. The G-α subunit, in turn, dissociated form the G-βγ subunits. The free G-α inactivates adenylate cyclase (AC), which, in turn, catalyzes the conversion of ATP to cAMP, the latter of which functioning as a second messenger. cAMP activates of the enzyme Protein Kinase A (PKA). PKA enters the nucleus and activates the cAMP response element-binding protein. The activated CREB binds along with CREB binding protein, co-activator to the CRE region of the DNA in the nucleus. CREB and CBP are held together by leucine zippers. CRE is the control that activates number of growth factors, and thus cell proliferation and some anti-apoptotic genes. In the brain, CREB plays a role in long-term memory and learning.

References

1. 
   ^ Ohki-Hamazaki H (October 2000). "Neuromedin B". Prog. Neurobiol. 62 (3): 297–312. doi:10.1016/S0301-0082(00)00004-6. PMID 10840151..mw-parser-output cite.citation{font-style:inherit}.mw-parser-output q{quotes:"""""""'""'"}.mw-parser-output code.cs1-code{color:inherit;background:inherit;border:inherit;padding:inherit}.mw-parser-output .cs1-lock-free a{background:url("//upload.wikimedia.org/wikipedia/commons/thumb/6/65/Lock-green.svg/9px-Lock-green.svg.png")no-repeat;background-position:right .1em center}.mw-parser-output .cs1-lock-limited a,.mw-parser-output .cs1-lock-registration a{background:url("//upload.wikimedia.org/wikipedia/commons/thumb/d/d6/Lock-gray-alt-2.svg/9px-Lock-gray-alt-2.svg.png")no-repeat;background-position:right .1em center}.mw-parser-output .cs1-lock-subscription a{background:url("//upload.wikimedia.org/wikipedia/commons/thumb/a/aa/Lock-red-alt-2.svg/9px-Lock-red-alt-2.svg.png")no-repeat;background-position:right .1em center}.mw-parser-output .cs1-subscription,.mw-parser-output .cs1-registration{color:#555}.mw-parser-output .cs1-subscription span,.mw-parser-output .cs1-registration span{border-bottom:1px dotted;cursor:help}.mw-parser-output .cs1-hidden-error{display:none;font-size:100%}.mw-parser-output .cs1-visible-error{font-size:100%}.mw-parser-output .cs1-subscription,.mw-parser-output .cs1-registration,.mw-parser-output .cs1-format{font-size:95%}.mw-parser-output .cs1-kern-left,.mw-parser-output .cs1-kern-wl-left{padding-left:0.2em}.mw-parser-output .cs1-kern-right,.mw-parser-output .cs1-kern-wl-right{padding-right:0.2em}
   


2. 
   ^ Jensen RT, Battey JF, Spindel ER, Benya RV (March 2008). "International Union of Pharmacology. LXVIII. Mammalian bombesin receptors: nomenclature, distribution, pharmacology, signaling, and functions in normal and disease states". Pharmacol. Rev. 60 (1): 1–42. doi:10.1124/pr.107.07108. PMC 2517428. PMID 18055507.
   


3. 
   ^ Krane IM, Naylor SL, Helin-Davis D, Chin WW, Spindel ER (15 September 1988). "Molecular cloning of cDNAs encoding the human bombesin-like peptide neuromedin B. Chromosomal localization and comparison to cDNAs encoding its amphibian homolog ranatensin". J. Biol. Chem. 263 (26): 13317–23. PMID 2458345.
   


4. 
   ^ Wada E, Way J, Lebacq-Verheyden AM, Battey JF (1 September 1990). "Neuromedin B and gastrin-releasing peptide mRNAs are differentially distributed in the rat nervous system". J. Neurosci. 10 (9): 2917–30. PMID 2398368.
   

External links

• 
  Neuromedin+B at the US National Library of Medicine Medical Subject Headings (MeSH)

v t e Peptides: neuropeptides
Hormones	see hormones
Opioid peptides	Dynorphins Dynorphin A Dynorphin A1–8 Dynorphin B Big dynorphin Leumorphin α-Neoendorphin β-Neoendorphin Endomorphins Endomorphin-1 Endomorphin-2 Endorphins α-Endorphin β-Endorphin γ-Endorphin Enkephalins Met-enkephalin Leu-enkephalin Others Adrenorphin Amidorphin Hemorphin Hemorphin-4 Nociceptin Opiorphin Spinorphin Valorphin
Other neuropeptides	Kinins Bradykinins Tachykinins: mammal Substance P Neurokinin A Neurokinin B amphibian Kassinin Physalaemin Neuromedins B N S U Orexins A B Other Angiotensin Bombesin Calcitonin gene-related peptide Carnosine Cocaine- and amphetamine-regulated transcript Delta sleep-inducing peptide FMRFamide Galanin Galanin-like peptide Gastrin-releasing peptide Ghrelin Neuropeptide AF Neuropeptide FF Neuropeptide SF Neuropeptide VF Neuropeptide S Neuropeptide Y Neurophysins Neurotensin Pancreatic polypeptide Pituitary adenylate cyclase-activating peptide RVD-Hpα VGF

This page is only for reference, If you need detailed information, please check here